missing translation for 'onlineSavingsMsg'
Learn More

alpha-Galactosidase A/GLA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP1-58018

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18215201

  • 471.91€ / 100 microlitros
Fecha estimada de envío: 21-08-2024
para ver el stock

Descripción

Descripción

alpha-Galactosidase A/GLA Polyclonal specifically detects alpha-Galactosidase A/GLA in Human samples. It is validated for Western Blot.
Especificaciones

Especificaciones

alpha-Galactosidase A/GLA
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
Agalsidase, agalsidase alfa, Alpha-D-galactosidase A, Alpha-D-galactoside galactohydrolase, alpha-D-galactoside galactohydrolase 1, alpha-gal A, alpha-galactosidase A, EC 3.2.1, EC 3.2.1.22, GALA, galactosidase, alpha, melibiase
Rabbit
Affinity purified
RUO
2717
Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution. Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
P06280
GLA
Synthetic peptides corresponding to GLA(galactosidase, alpha) The peptide sequence was selected from the N terminal of GLA (NP_000160). Peptide sequence PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF.
100 μL
Primary
Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Chicken: 92%; Rabbit: 92%; Zebrafish: 92%; Equine: 85%.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only