Learn More
Abnova™ AK2 Recombinant Protein
Human AK2 full-length ORF recombinant protein with GST-tag at N-terminal
Marke: Abnova™ H00000204-P01.25ug
Weitere Details : Peso : 0.00010kg
Beschreibung
Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Two transcript variants encoding distinct isoforms have been identified for this gene.
- Theoretical MW (kDa): 52.03
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHT
QTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI
Best use within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Spezifikation
Antibody Production, ELISA, Protein Array, Western Blot | |
52.03 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
25μg | |
-80°C | |
Recombinant |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
Human AK2 Full-length ORF Recombinant Protein with GST-tag at N-terminal | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE stained with Coomassie Blue | |
Wheat Germ (in vitro) | |
Human | |
Solution |