missing translation for 'onlineSavingsMsg'
Learn More

AGR2 Recombinant Protein, Abnova

Human full-length ORF recombinant protein with GST-tag at N-terminal

Marca:  Abnova H00010551-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16195302

  • 458.00€ / 25 microgramos


Fecha estimada de envío
19-10-2020
Añadir a la cesta

Descripción

Descripción

  • Encoded by anterior gradient homolog 2 gene
  • Molecular weight: 44.99kDa
  • Preparation method: in vitro wheat germ expression system
  • Purification: glutathione sepharose 4 fast flow
  • Storage buffer: 50 mM Tris-HCI, 10 mM reduced glutathione
  • pH=8.0 in elution buffer

Sequence: MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL

Best when used within three months from the date of receipt.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Especificaciones

AAH15503.1
Solution
10551
AGR2 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
AG2|GOB-4|HAG-2|XAG-2
AGR2
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
44.99
8
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AGR2
Human
Yes
Videos
Documentos