Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
952,836
results
Separase Antibody (XJ11-1B12) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
| Content And Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG1 κ |
| Gene Accession No. | Q14674 |
| Research Discipline | Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators |
| Concentration | 0.9 mg/mL |
| Antigen | Separase |
| Gene Symbols | ESPL1 |
| Regulatory Status | RUO |
| Purification Method | Protein G purified |
| Dilution | Western Blot 1:500 |
| Gene Alias | Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase |
| Gene ID (Entrez) | 9700 |
| Immunogen | Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674] |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | XJ11-1B12 |
| Purity or Quality Grade | >95%, by SDS-PAGE |
|---|---|
| Gene Alias | alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein |
| Gene ID (Entrez) | 6622 |
| Formulation | PBS pH 7.4 |
| Gene Symbol | SNCA |
| Research Category | Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience |
| Storage Requirements | Store at -80C. Avoid freeze-thaw cycles. |
| For Use With (Application) | Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
| Protein | alpha-Synuclein |
Novus Biologicals™ Human HBsAg ELISA Kit (Colorimetric)
ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.
| Gene Symbols | TP53BP1 |
|---|---|
| Gene Alias | 53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1 |
Listeria monocytogenes p60, Mouse anti-Bacteria, Clone: p6007, Novus Biologicals™
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Bacteria |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,ELISA |
| Form | Purified |
| Isotype | IgG1 κ |
| Concentration | 1 mg/mL |
| Antigen | Listeria monocytogenes p60 |
| Regulatory Status | RUO |
| Purification Method | Protein G purified |
| Dilution | Western Blot, ELISA |
| Gene Alias | IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein |
| Formulation | 0.2um-filtered solution in PBS, pH 7.4. |
| Immunogen | Recombinant Listeria monocytogenes p60. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Test Specificity | Recognizes Listeria monocytogenes p60 protein. Does not cross-react with other Listeria species. |
| Clone | p6007 |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Isotype | IgG |
| Research Discipline | Apoptosis |
| Concentration | 1.0 mg/mL |
| Antigen | Alix |
| Gene Symbols | PDCD6IP |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Gene Alias | AIP1DRIP4, ALG-2 interacting protein 1, ALG-2 interacting protein X, ALG-2-interacting protein 1, alinx, ALIX, apoptosis-linked gene 2-interacting protein X, dopamine receptor interacting protein 4, HP95, KIAA1375, MGC17003, PDCD6-interacting protein, programmed cell death 6 interacting protein, programmed cell death 6-interacting protein |
| Gene ID (Entrez) | 10015 |
| Formulation | PBS with 0.09% Sodium Azide |
| Immunogen | The immunogen for this product maps to a region between residue 818 and 868 of human Apoptosis-Linked Gene 2-Interacting Protein X using the numbering given in entry NP_037506.2 (GeneID 10015). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
GM130/GOLGA2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 6 publications
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Research Discipline | Cellular Markers, Golgi Apparatus Markers |
| Concentration | 1.0 mg/mL |
| Antigen | GM130/GOLGA2 |
| Gene Symbols | GOLGA2 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 0.5 ug/ml, Immunohistochemistry 1:1000 - 1:1500, Immunocytochemistry/Immunofluorescence 5 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:1500 |
| Gene Alias | 130 kDa cis-Golgi matrix protein, GM130 autoantigen, GM130Golgi matrix protein GM130, golgi autoantigen, golgin subfamily a, 2, golgin A2, Golgin subfamily A member 2, golgin-95, MGC20672, SY11 protein |
| Gene ID (Entrez) | 2801 |
| Formulation | PBS with 0.02% Sodium Azide |
| Immunogen | Partial recombinant human GM130/GOLGA2 protein (amino acids 528-606). [UniPro Q08379] |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
PAK1/2/3, p Thr423, p Thr402, p Thr421 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Rat,Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence |
| Isotype | IgG |
| Gene Accession No. | Q13153//Q13177//O75914 |
| Research Discipline | Apoptosis, Breast Cancer, Cancer, Neuroscience, Phospho Specific, Signal Transduction |
| Concentration | 1.0 mg/mL |
| Antigen | PAK1/2/3 (p Thr423, p Thr402, p Thr421) |
| Gene Symbols | PAK1 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Gene Alias | alpha-PAK, EC 2.7.11, EC 2.7.11.1, MGC130000, MGC130001, p21 protein (Cdc42/Rac)-activated kinase 1, p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast), p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related), p21-activated kinase 1, p65-PAK, PAK-1, PAKalpha, serine/threonine-protein kinase PAK 1, STE20 homolog, yeast |
| Gene ID (Entrez) | 5058 |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Antigen | RWDD4A |
| Gene Symbols | RWDD4 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Gene Alias | FAM28A, member A, MGC10198, Protein FAM28A, RWD domain containing 4, RWD domain containing 4A, RWD domain-containing protein 4, RWD domain-containing protein 4A, RWDD4A |
| Gene ID (Entrez) | 201965 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:EALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEISWTETYPQTPPILSMNAFFNNTISSAVKQSILAKLQEAVEANLGTAM |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of human RWDD4A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Novus Biologicals™ Fluorescent Exosome Standards (HCT116 cell line)
Highly pure, lyophilized exosome standards with superior stability, optimal for multiple applications