Bio Techne

1 – 15 de 951,841 résultats

Mouse Monoclonal Antibody has been used in 1 publication

Applications	Western Blot
Isotype	IgG1 κ
Conjugué	Unconjugated
Espèces cibles	Human
Concentration	0.9 mg/mL
Primaire ou secondaire	Primary
Contenu et stockage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Forme	Purified
État réglementaire	RUO
Numéro d’ordre du gène	Q14674
Dilution	Western Blot 1:500
Immunogène	Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674]
Classification	Monoclonal
Identification génétique (Entrez)	9700
Méthode de purification	Protein G purified
Disciplines de recherche	Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators
Espèces hôtes	Mouse
Symboles de gène(s)	ESPL1
Alias de gène	Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase
Clone	XJ11-1B12
Antigène	Separase

Mouse Monoclonal Antibody

Protéine	alpha-Synuclein
Conditions de stockage	Store at -80C. Avoid freeze-thaw cycles.
Catégorie de recherche	Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience
Pureté ou qualité	>95%, by SDS-PAGE
Identification génétique (Entrez)	6622
Symbole de gène(s)	SNCA
Formule	PBS pH 7.4
Alias de gène	alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein
À utiliser avec (application)	Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot

ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.

Rabbit Polyclonal Antibody

Symboles de gène(s)	TP53BP1
Alias de gène	53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1

Mouse Monoclonal Antibody

Applications	Western Blot,ELISA
Spécificité du test	Recognizes Listeria monocytogenes p60 protein. Does not cross-react with other Listeria species.
Isotype	IgG1 κ
Conjugué	Unconjugated
Espèces cibles	Bacteria
Concentration	1 mg/mL
Primaire ou secondaire	Primary
Contenu et stockage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Forme	Purified
État réglementaire	RUO
Dilution	Western Blot, ELISA
Immunogène	Recombinant Listeria monocytogenes p60.
Classification	Monoclonal
Méthode de purification	Protein G purified
Espèces hôtes	Mouse
Formule	0.2um-filtered solution in PBS, pH 7.4.
Alias de gène	IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein
Clone	p6007
Antigène	Listeria monocytogenes p60

Rabbit Polyclonal Antibody

Applications	Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin)
Spécificité du test	Specificity of human RWDD4A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype	IgG
Conjugué	Unconjugated
Espèces cibles	Human,Mouse,Rat
Primaire ou secondaire	Primary
Contenu et stockage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
État réglementaire	RUO
Dilution	Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Immunogène	This antibody was developed against Recombinant Protein corresponding to amino acids:EALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEISWTETYPQTPPILSMNAFFNNTISSAVKQSILAKLQEAVEANLGTAM
Classification	Polyclonal
Identification génétique (Entrez)	201965
Méthode de purification	Affinity Purified
Espèces hôtes	Rabbit
Symboles de gène(s)	RWDD4
Formule	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gène	FAM28A, member A, MGC10198, Protein FAM28A, RWD domain containing 4, RWD domain containing 4A, RWD domain-containing protein 4, RWD domain-containing protein 4A, RWDD4A
Antigène	RWDD4A

Native Protein

Mouse Monoclonal Antibody has been used in 4 publications

Applications	Western Blot
Spécificité du test	This antibody is specific for a and B subunits of CaMKII only when they are phosphorylated at Thr-286/287 (in B).
Isotype	IgG1
Conjugué	Unconjugated
Espèces cibles	Human
Concentration	1 mg/mL
Primaire ou secondaire	Primary
Contenu et stockage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Forme	Purified
État réglementaire	RUO
Numéro d’ordre du gène	P11275
Dilution	Western Blot 1 μg/mL, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Immunoblotting
Immunogène	Synthetic peptide
Classification	Monoclonal
Identification génétique (Entrez)	815
Méthode de purification	Protein G purified
Disciplines de recherche	Phospho Specific, Wnt Signaling Pathway
Espèces hôtes	Mouse
Symboles de gène(s)	CAMK2A
Alias de gène	calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha, calcium/calmodulin-dependent protein kinase II alpha, calcium/calmodulin-dependent protein kinase II alpha-B subunit, CaM kinase II alpha subunit, CaM kinase II subunit alpha, CAMKAcalcium/calmodulin-dependent protein kinase type II subunit alpha, CaMK-II alpha subunit, CaMK-II subunit alpha, CaMKIINalpha, CaM-kinase II alpha chain, EC 2.7.11, EC 2.7.11.17, KIAA0968calcium/calmodulin-dependent protein kinase type II alpha chain
Clone	22B1
Antigène	CaMKII alpha/beta (p Thr286, p Thr287)