Résultats de la recherche filtrée
Les produits de certains de nos fournisseurs ne s'affichent pas dans les résultats de la recherche filtrée. Veuillez
supprimer tous les filtres
pour voir ces produits.
1
–
15
de
941,676
résultats
Separase Antibody (XJ11-1B12) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
| Applications | Western Blot |
|---|---|
| Isotype | IgG1 κ |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Concentration | 0.9 mg/mL |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Forme | Purified |
| État réglementaire | RUO |
| Numéro d’ordre du gène | Q14674 |
| Dilution | Western Blot 1:500 |
| Immunogène | Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674] |
| Classification | Monoclonal |
| Identification génétique (Entrez) | 9700 |
| Méthode de purification | Protein G purified |
| Disciplines de recherche | Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators |
| Espèces hôtes | Mouse |
| Symboles de gène(s) | ESPL1 |
| Alias de gène | Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase |
| Clone | XJ11-1B12 |
| Antigène | Separase |
| Protéine | alpha-Synuclein |
|---|---|
| Conditions de stockage | Store at -80C. Avoid freeze-thaw cycles. |
| Catégorie de recherche | Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience |
| Pureté ou qualité | >95%, by SDS-PAGE |
| Identification génétique (Entrez) | 6622 |
| Symbole de gène(s) | SNCA |
| Formule | PBS pH 7.4 |
| Alias de gène | alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein |
| À utiliser avec (application) | Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
Novus Biologicals™ Human HBsAg ELISA Kit (Colorimetric)
ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.
| Symboles de gène(s) | TP53BP1 |
|---|---|
| Alias de gène | 53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1 |
Listeria monocytogenes p60, Mouse anti-Bacteria, Clone: p6007, Novus Biologicals™
Mouse Monoclonal Antibody
| Applications | Western Blot,ELISA |
|---|---|
| Spécificité du test | Recognizes Listeria monocytogenes p60 protein. Does not cross-react with other Listeria species. |
| Isotype | IgG1 κ |
| Conjugué | Unconjugated |
| Espèces cibles | Bacteria |
| Concentration | 1 mg/mL |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Forme | Purified |
| État réglementaire | RUO |
| Dilution | Western Blot, ELISA |
| Immunogène | Recombinant Listeria monocytogenes p60. |
| Classification | Monoclonal |
| Méthode de purification | Protein G purified |
| Espèces hôtes | Mouse |
| Formule | 0.2um-filtered solution in PBS, pH 7.4. |
| Alias de gène | IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein |
| Clone | p6007 |
| Antigène | Listeria monocytogenes p60 |
Novus Biologicals™ Total Superoxide Dismutase/T-SOD Activity Assay Kit (Colorimetric)
Assay Kit (Colorimetric)
| Isotype | IgG |
|---|---|
| Conjugué | Unconjugated |
| Concentration | 1.0 mg/mL |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| État réglementaire | RUO |
| Immunogène | The immunogen for this product maps to a region between residue 818 and 868 of human Apoptosis-Linked Gene 2-Interacting Protein X using the numbering given in entry NP_037506.2 (GeneID 10015). |
| Classification | Polyclonal |
| Identification génétique (Entrez) | 10015 |
| Méthode de purification | Affinity Purified |
| Disciplines de recherche | Apoptosis |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | PDCD6IP |
| Formule | PBS with 0.09% Sodium Azide |
| Alias de gène | AIP1DRIP4, ALG-2 interacting protein 1, ALG-2 interacting protein X, ALG-2-interacting protein 1, alinx, ALIX, apoptosis-linked gene 2-interacting protein X, dopamine receptor interacting protein 4, HP95, KIAA1375, MGC17003, PDCD6-interacting protein, programmed cell death 6 interacting protein, programmed cell death 6-interacting protein |
| Antigène | Alix |
PAK1/2/3, p Thr423, p Thr402, p Thr421 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
| Applications | Immunohistochemistry (Paraffin),Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence |
|---|---|
| Isotype | IgG |
| Conjugué | Unconjugated |
| Espèces cibles | Rat,Human,Mouse |
| Concentration | 1.0 mg/mL |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| État réglementaire | RUO |
| Numéro d’ordre du gène | Q13153//Q13177//O75914 |
| Classification | Polyclonal |
| Identification génétique (Entrez) | 5058 |
| Méthode de purification | Affinity Purified |
| Disciplines de recherche | Apoptosis, Breast Cancer, Cancer, Neuroscience, Phospho Specific, Signal Transduction |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | PAK1 |
| Alias de gène | alpha-PAK, EC 2.7.11, EC 2.7.11.1, MGC130000, MGC130001, p21 protein (Cdc42/Rac)-activated kinase 1, p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast), p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related), p21-activated kinase 1, p65-PAK, PAK-1, PAKalpha, serine/threonine-protein kinase PAK 1, STE20 homolog, yeast |
| Antigène | PAK1/2/3 (p Thr423, p Thr402, p Thr421) |
| Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
|---|---|
| Spécificité du test | Specificity of human RWDD4A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Conjugué | Unconjugated |
| Espèces cibles | Human,Mouse,Rat |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| État réglementaire | RUO |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Immunogène | This antibody was developed against Recombinant Protein corresponding to amino acids:EALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEISWTETYPQTPPILSMNAFFNNTISSAVKQSILAKLQEAVEANLGTAM |
| Classification | Polyclonal |
| Identification génétique (Entrez) | 201965 |
| Méthode de purification | Affinity Purified |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | RWDD4 |
| Formule | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gène | FAM28A, member A, MGC10198, Protein FAM28A, RWD domain containing 4, RWD domain containing 4A, RWD domain-containing protein 4, RWD domain-containing protein 4A, RWDD4A |
| Antigène | RWDD4A |