Gefilterte Suchergebnisse
Produkte von einigen unserer Lieferanten werden in den gefilterten Suchergebnissen nicht angezeigt. Bitte
deaktivieren Sie alle Filter,
um diese Produkte zu sehen.
1
–
15
von
946,857
Ergebnisse
Separase Antibody (XJ11-1B12) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
| Klon | XJ11-1B12 |
|---|---|
| Form | Purified |
| Gen-Zugriffsnummer | Q14674 |
| Konjugat | Unconjugated |
| Isotype | IgG1 κ |
| Gensymbole | ESPL1 |
| Konzentration | 0.9 mg/mL |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Klassifikation | Monoclonal |
| Antigen | Separase |
| Regulatorischer Status | RUO |
| Immunogen | Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674] |
| Zielspezies | Human |
| Forschungsgebiet | Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators |
| Wirtsspezies | Mouse |
| Reinigungsverfahren | Protein G purified |
| Anwendungen | Western Blot |
| Verdünnung | Western Blot 1:500 |
| Gen-Alias | Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase |
| Gen-ID (Entrez) | 9700 |
| Gensymbol | SNCA |
|---|---|
| Zusammensetzung | PBS pH 7.4 |
| Lagerungsbedingungen | Store at -80C. Avoid freeze-thaw cycles. |
| Forschungskategorie | Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience |
| Zur Verwendung mit (Anwendung) | Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
| Gen-Alias | alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein |
| Protein | alpha-Synuclein |
| Reinheits- oder Qualitätsgrad | >95%, by SDS-PAGE |
| Gen-ID (Entrez) | 6622 |
Novus Biologicals™ Human HBsAg ELISA Kit (Colorimetric)
ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.
| Gensymbole | TP53BP1 |
|---|---|
| Gen-Alias | 53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1 |
Listeria monocytogenes p60, Mouse anti-Bacteria, Clone: p6007, Novus Biologicals™
Mouse Monoclonal Antibody
| Testspezifität | Recognizes Listeria monocytogenes p60 protein. Does not cross-react with other Listeria species. |
|---|---|
| Klon | p6007 |
| Form | Purified |
| Konjugat | Unconjugated |
| Isotype | IgG1 κ |
| Konzentration | 1 mg/mL |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | 0.2um-filtered solution in PBS, pH 7.4. |
| Klassifikation | Monoclonal |
| Antigen | Listeria monocytogenes p60 |
| Regulatorischer Status | RUO |
| Immunogen | Recombinant Listeria monocytogenes p60. |
| Zielspezies | Bacteria |
| Wirtsspezies | Mouse |
| Reinigungsverfahren | Protein G purified |
| Anwendungen | Western Blot,ELISA |
| Verdünnung | Western Blot, ELISA |
| Gen-Alias | IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein |
Novus Biologicals™ Total Superoxide Dismutase/T-SOD Activity Assay Kit (Colorimetric)
Assay Kit (Colorimetric)
| Konjugat | Unconjugated |
|---|---|
| Isotype | IgG |
| Gensymbole | PDCD6IP |
| Konzentration | 1.0 mg/mL |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS with 0.09% Sodium Azide |
| Klassifikation | Polyclonal |
| Antigen | Alix |
| Regulatorischer Status | RUO |
| Immunogen | The immunogen for this product maps to a region between residue 818 and 868 of human Apoptosis-Linked Gene 2-Interacting Protein X using the numbering given in entry NP_037506.2 (GeneID 10015). |
| Forschungsgebiet | Apoptosis |
| Wirtsspezies | Rabbit |
| Reinigungsverfahren | Affinity Purified |
| Gen-Alias | AIP1DRIP4, ALG-2 interacting protein 1, ALG-2 interacting protein X, ALG-2-interacting protein 1, alinx, ALIX, apoptosis-linked gene 2-interacting protein X, dopamine receptor interacting protein 4, HP95, KIAA1375, MGC17003, PDCD6-interacting protein, programmed cell death 6 interacting protein, programmed cell death 6-interacting protein |
| Gen-ID (Entrez) | 10015 |
PAK1/2/3, p Thr423, p Thr402, p Thr421 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
| Gen-Zugriffsnummer | Q13153//Q13177//O75914 |
|---|---|
| Konjugat | Unconjugated |
| Isotype | IgG |
| Gensymbole | PAK1 |
| Konzentration | 1.0 mg/mL |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Klassifikation | Polyclonal |
| Antigen | PAK1/2/3 (p Thr423, p Thr402, p Thr421) |
| Regulatorischer Status | RUO |
| Zielspezies | Rat,Human,Mouse |
| Forschungsgebiet | Apoptosis, Breast Cancer, Cancer, Neuroscience, Phospho Specific, Signal Transduction |
| Wirtsspezies | Rabbit |
| Reinigungsverfahren | Affinity Purified |
| Anwendungen | Immunohistochemistry (Paraffin),Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence |
| Gen-Alias | alpha-PAK, EC 2.7.11, EC 2.7.11.1, MGC130000, MGC130001, p21 protein (Cdc42/Rac)-activated kinase 1, p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast), p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related), p21-activated kinase 1, p65-PAK, PAK-1, PAKalpha, serine/threonine-protein kinase PAK 1, STE20 homolog, yeast |
| Gen-ID (Entrez) | 5058 |
| Testspezifität | Specificity of human RWDD4A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
|---|---|
| Konjugat | Unconjugated |
| Isotype | IgG |
| Gensymbole | RWDD4 |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Klassifikation | Polyclonal |
| Antigen | RWDD4A |
| Regulatorischer Status | RUO |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:EALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEISWTETYPQTPPILSMNAFFNNTISSAVKQSILAKLQEAVEANLGTAM |
| Zielspezies | Human,Mouse,Rat |
| Wirtsspezies | Rabbit |
| Reinigungsverfahren | Affinity Purified |
| Anwendungen | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Verdünnung | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Gen-Alias | FAM28A, member A, MGC10198, Protein FAM28A, RWD domain containing 4, RWD domain containing 4A, RWD domain-containing protein 4, RWD domain-containing protein 4A, RWDD4A |
| Gen-ID (Entrez) | 201965 |