Sequence: SILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEGNTNFLIPEYHCILEEADHLQEEYKKQPAHLERLYG
Bardet-Biedl syndrome 7 protein; BBS2-like 1; BBS2-like protein 1; BBS2L1/FLJ10715
Cat # 16137996
100 µg
Cat # 16117996
50 µg
Cat # 16197986
50 uL
Cat # 16027637
100 ug
Cat # 15728591
100 µL
Cat # 15574881
100 µg
Cat # 16848764
150 µL
Cat # 16871684
150 µL
Cat # 17289263
100 µL
Cat # 13260049
100 µL
Cat # 15735106
0.1 ml
Cat # 16881684
20 µL
Cat # 16858764
20 µL
Cat # 16612785
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.